SCOPe 2.05: Domain d4u6vl2: 4u6v L:106-213

Lineage for d4u6vl2 (4u6v L:106-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4u6vl2: 4u6v L:106-213 [260083]
   Other proteins in same PDB: d4u6va_, d4u6vb_, d4u6vl1, d4u6vm1
   automated match to d1dn0a2
   complexed with so4

Details for d4u6vl2

PDB Entry: 4u6v, 2.56 Å

PDB Description: Mechanisms of Neutralization of a Human Anti-Alpha Toxin Antibody

PDB Compounds: (L:) Fab, antigen binding fragment, light chain

SCOPe Domain Sequences for d4u6vl2:

Sequence; same for both SEQRES and ATOM records:

>d4u6vl2 b.1.1.2 (L:106-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4u6vl2:

• d4u6vl2 first appeared in SCOPe 2.04
  
• d4u6vl2 appears in SCOPe 2.06
  
• d4u6vl2 appears in the current release, SCOPe 2.08