Lineage for d4u8hc2 (4u8h C:224-510)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006420Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2006421Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2006422Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)
  6. 2006454Protein automated matches [228408] (1 species)
    not a true protein
  7. 2006455Species Mouse (Mus musculus) [TaxId:10090] [228409] (5 PDB entries)
  8. 2006465Domain d4u8hc2: 4u8h C:224-510 [260077]
    Other proteins in same PDB: d4u8ha1, d4u8hc1
    automated match to d4i6ga2
    complexed with zn

Details for d4u8hc2

PDB Entry: 4u8h (more details), 2.8 Å

PDB Description: crystal structure of mammalian period-cryptochrome complex
PDB Compounds: (C:) Cryptochrome-2

SCOPe Domain Sequences for d4u8hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u8hc2 a.99.1.1 (C:224-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpavwqggetealarldkhlerkawvanyerprmnansllasptglspylrfgclscrlf
yyrlwdlykkvkrnstpplslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpe
alakwaegktgfpwidaimtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdell
ldadfsvnagswmwlscsaffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiy
epwnapesvqkaakciigvdyprpivnhaetsrlniermkqiyqqls

SCOPe Domain Coordinates for d4u8hc2:

Click to download the PDB-style file with coordinates for d4u8hc2.
(The format of our PDB-style files is described here.)

Timeline for d4u8hc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u8hc1