SCOPe 2.07: Domain d4u8hc2: 4u8h C:224-510

Lineage for d4u8hc2 (4u8h C:224-510)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families)
   automatically mapped to Pfam PF03441

5. Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 protein domains)

6. Protein automated matches [228408] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [228409] (5 PDB entries)

8. Domain d4u8hc2: 4u8h C:224-510 [260077]
   Other proteins in same PDB: d4u8ha1, d4u8hc1
   automated match to d4i6ga2
   complexed with zn

Details for d4u8hc2

PDB Entry: 4u8h, 2.8 Å

PDB Description: crystal structure of mammalian period-cryptochrome complex

PDB Compounds: (C:) Cryptochrome-2

SCOPe Domain Sequences for d4u8hc2:

Sequence; same for both SEQRES and ATOM records:

>d4u8hc2 a.99.1.1 (C:224-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpavwqggetealarldkhlerkawvanyerprmnansllasptglspylrfgclscrlf
yyrlwdlykkvkrnstpplslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpe
alakwaegktgfpwidaimtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdell
ldadfsvnagswmwlscsaffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiy
epwnapesvqkaakciigvdyprpivnhaetsrlniermkqiyqqls

Timeline for d4u8hc2:

• d4u8hc2 first appeared in SCOPe 2.04
  
• d4u8hc2 appears in SCOPe 2.06