Lineage for d2stae_ (2sta E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60859Protein Trypsin(ogen) [50515] (6 species)
  7. 61007Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (6 PDB entries)
  8. 61013Domain d2stae_: 2sta E: [26007]
    Other proteins in same PDB: d2stai_

Details for d2stae_

PDB Entry: 2sta (more details), 1.8 Å

PDB Description: anionic salmon trypsin in complex with squash seed inhibitor (cucurbita maxima trypsin inhibitor i)

SCOP Domain Sequences for d2stae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stae_ b.47.1.2 (E:) Trypsin(ogen) {North atlantic salmon (Salmo salar)}
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

SCOP Domain Coordinates for d2stae_:

Click to download the PDB-style file with coordinates for d2stae_.
(The format of our PDB-style files is described here.)

Timeline for d2stae_: