Lineage for d4u21a1 (4u21 A:3-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2913899Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)
  8. 2913918Domain d4u21a1: 4u21 A:3-263 [260063]
    Other proteins in same PDB: d4u21a2
    automated match to d4fata_
    complexed with fwd, fwf

Details for d4u21a1

PDB Entry: 4u21 (more details), 1.39 Å

PDB Description: glua2flip slbd complexed with fw and (r,r)-2b crystal form e
PDB Compounds: (A:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d4u21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u21a1 c.94.1.1 (A:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlkls
eqgvldklknkwwydkgecgs

SCOPe Domain Coordinates for d4u21a1:

Click to download the PDB-style file with coordinates for d4u21a1.
(The format of our PDB-style files is described here.)

Timeline for d4u21a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u21a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4u21b_