Lineage for d4txob_ (4txo B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879281Species Bradyrhizobium diazoefficiens [TaxId:224911] [260057] (3 PDB entries)
  8. 2879285Domain d4txob_: 4txo B: [260058]
    Other proteins in same PDB: d4txoa_, d4txoc_, d4txoe_, d4txog_
    automated match to d2gqla_
    complexed with na, peg, scn

Details for d4txob_

PDB Entry: 4txo (more details), 2.2 Å

PDB Description: crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)
PDB Compounds: (B:) Blr1131 protein

SCOPe Domain Sequences for d4txob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4txob_ c.47.1.0 (B:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]}
aaiggpfqltdqngkavtdkslkgkptliffgythspdvcptslfeisevlramgkdadk
vnaifisvdperdtpatmknylssfdphleglsgdpaeiakvitsyrvyakkvptkdgdy
tmdhtaliylmdrdgrfvspfnlkrtpeeaaadlkryl

SCOPe Domain Coordinates for d4txob_:

Click to download the PDB-style file with coordinates for d4txob_.
(The format of our PDB-style files is described here.)

Timeline for d4txob_: