Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.0: automated matches [191667] (1 protein) not a true family |
Protein automated matches [191267] (5 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [260051] (1 PDB entry) |
Domain d4tuma_: 4tum A: [260053] automated match to d3hg0d_ |
PDB Entry: 4tum (more details), 2.3 Å
SCOPe Domain Sequences for d4tuma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tuma_ d.211.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} esivhqtaslgdveglkaalasggnkdeedsegrtalhfacgygelkcaqvlidagasvn avdknkntplhyaagygrkecvslllengaavtlqnldektpidvaklnsqlevvkllek da
Timeline for d4tuma_:
View in 3D Domains from other chains: (mouse over for more information) d4tumb_, d4tumc_, d4tumd_, d4tume_ |