Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (16 PDB entries) |
Domain d4tuya2: 4tuy A:246-438 [260049] Other proteins in same PDB: d4tuya1, d4tuyb1, d4tuyc1, d4tuyd1, d4tuye_ automated match to d4i50a2 complexed with 36l, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 4tuy (more details), 2.1 Å
SCOPe Domain Sequences for d4tuya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tuya2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvd
Timeline for d4tuya2: