Lineage for d4trib_ (4tri B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005724Species Mycobacterium smegmatis [TaxId:246196] [231662] (5 PDB entries)
  8. 2005737Domain d4trib_: 4tri B: [260046]
    Other proteins in same PDB: d4tria2
    automated match to d3zbyd_
    complexed with c3s, gol, hem

Details for d4trib_

PDB Entry: 4tri (more details), 2 Å

PDB Description: x-ray crystal structure of cyp142a2 from mycobacterium smegmatis, complexed with cholesterol sulfate.
PDB Compounds: (B:) p450 heme-thiolate protein

SCOPe Domain Sequences for d4trib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4trib_ a.104.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
tqmltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpel
fsstggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavc
ergecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdt
faayteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrht
lsggteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelrag
ekimlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervl
rrlpdlrladdapvplrpanfvsgpesmpvvftpsapvla

SCOPe Domain Coordinates for d4trib_:

Click to download the PDB-style file with coordinates for d4trib_.
(The format of our PDB-style files is described here.)

Timeline for d4trib_: