Lineage for d1a0jc_ (1a0j C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15472Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (6 PDB entries)
  8. 15475Domain d1a0jc_: 1a0j C: [26004]

Details for d1a0jc_

PDB Entry: 1a0j (more details), 1.7 Å

PDB Description: crystal structure of a non-psychrophilic trypsin from a cold-adapted fish species.

SCOP Domain Sequences for d1a0jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0jc_ b.47.1.2 (C:) Trypsin(ogen) {North atlantic salmon (Salmo salar)}
ivggyecrknsasyqaslqsgyhfcggslisstwvvsaahcyksriqvrlgehniavneg
teqfidsvkvimhpsynsrnldndimliklskpaslnsyvstvalpsscassgtrclvsg
wgnlsgsssnypdtlrcldlpilsssscnsaypgqitsnmfcagfmeggkdscqgdsggp
vvcngqlqgvvswgygcaqrnkpgvytkvcnyrswisstmssn

SCOP Domain Coordinates for d1a0jc_:

Click to download the PDB-style file with coordinates for d1a0jc_.
(The format of our PDB-style files is described here.)

Timeline for d1a0jc_: