Lineage for d4tkua_ (4tku A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624120Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1624224Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1624279Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 1624372Protein automated matches [190199] (1 species)
    not a true protein
  7. 1624373Species Azotobacter vinelandii [TaxId:354] [186943] (7 PDB entries)
  8. 1624376Domain d4tkua_: 4tku A: [260022]
    Other proteins in same PDB: d4tkub_, d4tkud_
    automated match to d1m34a_
    complexed with cl, clf, fe2, hca, ics, imd

Details for d4tkua_

PDB Entry: 4tku (more details), 1.43 Å

PDB Description: Reactivated Nitrogenase MoFe-protein from A. vinelandii
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d4tkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tkua_ c.92.2.3 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfrqmhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d4tkua_:

Click to download the PDB-style file with coordinates for d4tkua_.
(The format of our PDB-style files is described here.)

Timeline for d4tkua_: