Lineage for d1a0ja_ (1a0j A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species North atlantic salmon (Salmo salar) [TaxId:8030] [50520] (6 PDB entries) 
Domain d1a0ja_: 1a0j A: [26002]
Details for d1a0ja_
PDB Entry: 1a0j (more details), 1.7 Å
PDB Description: crystal structure of a non-psychrophilic trypsin from a cold-adapted fish species.
SCOP Domain Sequences for d1a0ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0ja_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar)}
ivggyecrknsasyqaslqsgyhfcggslisstwvvsaahcyksriqvrlgehniavneg
teqfidsvkvimhpsynsrnldndimliklskpaslnsyvstvalpsscassgtrclvsg
wgnlsgsssnypdtlrcldlpilsssscnsaypgqitsnmfcagfmeggkdscqgdsggp
vvcngqlqgvvswgygcaqrnkpgvytkvcnyrswisstmssn
SCOP Domain Coordinates for d1a0ja_:
Click to download the PDB-style file with coordinates for d1a0ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a0ja_:
- d1a0ja_ appears in SCOP 1.57
- d1a0ja_ appears in the current release, SCOPe 2.08
View in 3D
