SCOPe 2.08: Domain d4rcob2: 4rco B:208-308

Lineage for d4rcob2 (4rco B:208-308)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226096] (8 PDB entries)

8. Domain d4rcob2: 4rco B:208-308 [260018]
   Other proteins in same PDB: d4rcoa1, d4rcob1
   automated match to d2rdga2
   complexed with cl

Details for d4rcob2

PDB Entry: 4rco, 1.9 Å

PDB Description: 1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d4rcob2:

Sequence; same for both SEQRES and ATOM records:

>d4rcob2 d.15.6.0 (B:208-308) automated matches {Staphylococcus aureus [TaxId: 93061]}
kvdhkagvritkednkgtishdvsefkitkeqislkeldfklrkqlieknnlygnvgsgk
ivikmknggkytfelhkklqenrmadvidgtnidnievnik

Timeline for d4rcob2:

• d4rcob2 first appeared in SCOPe 2.04
  
• d4rcob2 appears in SCOPe 2.07