Lineage for d4ra0c1 (4ra0 C:27-130)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766425Domain d4ra0c1: 4ra0 C:27-130 [260012]
    automated match to d1rhfa1
    complexed with ca, cl, ni, so4

Details for d4ra0c1

PDB Entry: 4ra0 (more details), 3.07 Å

PDB Description: an engineered axl 'decoy receptor' effectively silences the gas6-axl signaling axis
PDB Compounds: (C:) tyrosine-protein kinase receptor ufo

SCOPe Domain Sequences for d4ra0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ra0c1 b.1.1.0 (C:27-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
espfvsnpgnitgargltgtlrcqlqvqgeppevhwlrdgqileladstqtqvplgedeq
gdwivasqlritslqlsdtgqyqclvflghqtfvsqpgyvrleg

SCOPe Domain Coordinates for d4ra0c1:

Click to download the PDB-style file with coordinates for d4ra0c1.
(The format of our PDB-style files is described here.)

Timeline for d4ra0c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ra0c2