Lineage for d4r9lc_ (4r9l C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641268Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
    automatically mapped to Pfam PF07858
  6. 1641269Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)
  7. 1641270Species Rhodococcus erythropolis [TaxId:1833] [89856] (4 PDB entries)
  8. 1641276Domain d4r9lc_: 4r9l C: [260010]
    automated match to d1nu3b_
    complexed with hyh; mutant

Details for d4r9lc_

PDB Entry: 4r9l (more details), 1.8 Å

PDB Description: structure of a thermostable elevenfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis, containing two stabilizing disulfide bonds
PDB Compounds: (C:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4r9lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r9lc_ d.17.4.8 (C:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
ceqprwaskdpaagkastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
daveqtlaglfkvmsidavcvfhicsckglvftervdvlralptgksynlsilgvfqltd
gkitgwrdyfdlrefeeavdlplrgklgpeqkliseedln

SCOPe Domain Coordinates for d4r9lc_:

Click to download the PDB-style file with coordinates for d4r9lc_.
(The format of our PDB-style files is described here.)

Timeline for d4r9lc_: