SCOPe 2.08: Domain d4r9lc1: 4r9l C:5-149

Lineage for d4r9lc1 (4r9l C:5-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
   automatically mapped to Pfam PF07858

6. Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [89856] (17 PDB entries)

8. Domain d4r9lc1: 4r9l C:5-149 [260010]
   Other proteins in same PDB: d4r9la2, d4r9lb2, d4r9lc2
   automated match to d1nu3b_
   complexed with hyh; mutant

Details for d4r9lc1

PDB Entry: 4r9l, 1.8 Å

PDB Description: structure of a thermostable elevenfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis, containing two stabilizing disulfide bonds

PDB Compounds: (C:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4r9lc1:

Sequence; same for both SEQRES and ATOM records:

>d4r9lc1 d.17.4.8 (C:5-149) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
ceqprwaskdpaagkastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
daveqtlaglfkvmsidavcvfhicsckglvftervdvlralptgksynlsilgvfqltd
gkitgwrdyfdlrefeeavdlplrg

Timeline for d4r9lc1:

• d4r9lc1 first appeared in SCOPe 2.04, called d4r9lc_
  
• d4r9lc1 appears in SCOPe 2.07