Lineage for d1trnb_ (1trn B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953999Protein Trypsin(ogen) [50515] (9 species)
  7. 954388Species Human (Homo sapiens) [TaxId:9606] [50519] (2 PDB entries)
  8. 954392Domain d1trnb_: 1trn B: [26001]
    complexed with isp

Details for d1trnb_

PDB Entry: 1trn (more details), 2.2 Å

PDB Description: crystal structure of human trypsin 1: unexpected phosphorylation of tyrosine 151
PDB Compounds: (B:) Trypsin

SCOPe Domain Sequences for d1trnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trnb_ b.47.1.2 (B:) Trypsin(ogen) {Human (Homo sapiens) [TaxId: 9606]}
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrktlnndimliklssravinarvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdsggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

SCOPe Domain Coordinates for d1trnb_:

Click to download the PDB-style file with coordinates for d1trnb_.
(The format of our PDB-style files is described here.)

Timeline for d1trnb_: