Lineage for d4r82a_ (4r82 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055435Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2055436Protein automated matches [190439] (20 species)
    not a true protein
  7. 2055484Species Streptomyces globisporus [TaxId:1908] [256294] (2 PDB entries)
  8. 2055493Domain d4r82a_: 4r82 A: [260009]
    automated match to d4hx6g_
    complexed with act, ca, cl, fad, mg, nad

Details for d4r82a_

PDB Entry: 4r82 (more details), 1.66 Å

PDB Description: streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 in complex with nad and fad fragments
PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d4r82a_:

Sequence, based on SEQRES records: (download)

>d4r82a_ b.45.1.0 (A:) automated matches {Streptomyces globisporus [TaxId: 1908]}
paelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvlicvgkda
vmhqrltalptfavsvleagqekaarhfadhsrppgvdqfdtvdwvlgeesgapliagav
ahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapdad

Sequence, based on observed residues (ATOM records): (download)

>d4r82a_ b.45.1.0 (A:) automated matches {Streptomyces globisporus [TaxId: 1908]}
paelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvlicvgkda
vmhqrltalptfavsvleagqekaarhfadhsvdqfdtvdwvlgeesgapliagavahle
caihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapdad

SCOPe Domain Coordinates for d4r82a_:

Click to download the PDB-style file with coordinates for d4r82a_.
(The format of our PDB-style files is described here.)

Timeline for d4r82a_: