Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.1: NagB-like [52513] (3 proteins) share a common phosphate-binding site with the RpiA family |
Protein automated matches [191092] (2 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [260006] (1 PDB entry) |
Domain d4r7tc_: 4r7t C: [260007] automated match to d1fsfa_ complexed with cl, fmt, gol, mg |
PDB Entry: 4r7t (more details), 2.1 Å
SCOPe Domain Sequences for d4r7tc_:
Sequence, based on SEQRES records: (download)
>d4r7tc_ c.124.1.1 (C:) automated matches {Vibrio cholerae [TaxId: 243277]} mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdgdinq vpkyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcd epstqelkvktvkyfteleaknivgf
>d4r7tc_ c.124.1.1 (C:) automated matches {Vibrio cholerae [TaxId: 243277]} mrliplkaaaqvgkwaaahivkrinefqptaerpfvlglptggtplatykaliemhkage vsfkhvvtfnmdeyvglaadhpesyrsfmynnffnhidiqeeninllngntddheaeckr yedkiksygkinlfmggvgndghiafnepasslssrtriktltedtriansrffdinqvp kyaltigvgtlldaqeimilvtghnkalalqaavegsvnhlwtvsalqlhpkavivcdep stqelkvktvkyfteleaknivgf
Timeline for d4r7tc_: