Lineage for d4r1sb_ (4r1s B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108379Species Petunia x [TaxId:4102] [260002] (2 PDB entries)
  8. 2108381Domain d4r1sb_: 4r1s B: [260003]
    automated match to d3hfsa_
    complexed with nap

Details for d4r1sb_

PDB Entry: 4r1s (more details), 1.6 Å

PDB Description: Crystal structure of Petunia hydrida cinnamoyl-CoA reductase
PDB Compounds: (B:) Cinnamoyl CoA reductase

SCOPe Domain Sequences for d4r1sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r1sb_ c.2.1.0 (B:) automated matches {Petunia x [TaxId: 4102]}
vsgqvvcvtgaggfiaswlvkillekgytvrgtvrnpddpknghlrelegakerltlcka
dlldyqslreaingcdgvfhtaspvtddpeqmvepavigtknvinaaaeanvrrvvftss
igavymdpnrdpetvvdetcwsdpdfckntknwycygkmvaeqaaweeakekgvdlvvin
pvlvqgpllqttvnasvlhilkyltgsaktyansvqayvdvkdvalahillyetpeasgr
ylcaesvlhrgdvveilskffpeypiptkcsdvtkprvkpykfsnqklkdlgleftpvkq
clyetvkslqekghlpip

SCOPe Domain Coordinates for d4r1sb_:

Click to download the PDB-style file with coordinates for d4r1sb_.
(The format of our PDB-style files is described here.)

Timeline for d4r1sb_: