Lineage for d1trna_ (1trn A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15461Species Human (Homo sapiens) [TaxId:9606] [50519] (1 PDB entry)
  8. 15462Domain d1trna_: 1trn A: [26000]

Details for d1trna_

PDB Entry: 1trn (more details), 2.2 Å

PDB Description: crystal structure of human trypsin 1: unexpected phosphorylation of tyrosine 151

SCOP Domain Sequences for d1trna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trna_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens)}
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrktlnndimliklssravinarvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdsggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

SCOP Domain Coordinates for d1trna_:

Click to download the PDB-style file with coordinates for d1trna_.
(The format of our PDB-style files is described here.)

Timeline for d1trna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1trnb_