Lineage for d4qx0a3 (4qx0 A:500-644)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775016Species Bacillus thuringiensis [TaxId:1444] [258998] (4 PDB entries)
  8. 2775018Domain d4qx0a3: 4qx0 A:500-644 [259998]
    Other proteins in same PDB: d4qx0a1, d4qx0a2
    automated match to d1dlca1

Details for d4qx0a3

PDB Entry: 4qx0 (more details), 2.8 Å

PDB Description: cry3a toxin structure obtained by serial femtosecond crystallography from in vivo grown crystals isolated from bacillus thuringiensis and data processed with the cctbx.xfel software suite
PDB Compounds: (A:) Pesticidal crystal protein cry3Aa

SCOPe Domain Sequences for d4qx0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qx0a3 b.18.1.0 (A:500-644) automated matches {Bacillus thuringiensis [TaxId: 1444]}
ffnmidskkitqlplvkayklqsgasvvagprftggdiiqctengsaatiyvtpdvsysq
kyrarihyastsqitftlsldgapfnqyyfdktinkgdtltynsfnlasfstpfelsgnn
lqigvtglsagdkvyidkiefipvn

SCOPe Domain Coordinates for d4qx0a3:

Click to download the PDB-style file with coordinates for d4qx0a3.
(The format of our PDB-style files is described here.)

Timeline for d4qx0a3: