Lineage for d4qx0a2 (4qx0 A:290-499)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402528Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 2402541Family b.77.2.0: automated matches [254290] (1 protein)
    not a true family
  6. 2402542Protein automated matches [254673] (3 species)
    not a true protein
  7. 2402549Species Bacillus thuringiensis [TaxId:1444] [258996] (4 PDB entries)
  8. 2402550Domain d4qx0a2: 4qx0 A:290-499 [259997]
    Other proteins in same PDB: d4qx0a1, d4qx0a3
    automated match to d1dlca2

Details for d4qx0a2

PDB Entry: 4qx0 (more details), 2.8 Å

PDB Description: cry3a toxin structure obtained by serial femtosecond crystallography from in vivo grown crystals isolated from bacillus thuringiensis and data processed with the cctbx.xfel software suite
PDB Compounds: (A:) Pesticidal crystal protein cry3Aa

SCOPe Domain Sequences for d4qx0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qx0a2 b.77.2.0 (A:290-499) automated matches {Bacillus thuringiensis [TaxId: 1444]}
lypkevkteltrdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpg
yygndsfnywsgnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnla
vwpsavysgvtkvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgy
shqlnyvmcflmqgsrgtipvltwthksvd

SCOPe Domain Coordinates for d4qx0a2:

Click to download the PDB-style file with coordinates for d4qx0a2.
(The format of our PDB-style files is described here.)

Timeline for d4qx0a2: