Lineage for d4qmea4 (4qme A:540-867)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726041Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein)
    PubMed 17876832; C-terminal part of Pfam PF11940
    this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain
  6. 2726042Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species)
  7. 2726043Species Neisseria meningitidis [TaxId:122586] [254838] (9 PDB entries)
  8. 2726044Domain d4qmea4: 4qme A:540-867 [259985]
    Other proteins in same PDB: d4qmea1, d4qmea2, d4qmea3
    automated match to d2gtqa4
    complexed with 37b, gol, imd, so4, zn

Details for d4qmea4

PDB Entry: 4qme (more details), 1.6 Å

PDB Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qmea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qmea4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]}
pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis
ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa
kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn
gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk
arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn
lvkqalqriraqeglskdvgeivgkild

SCOPe Domain Coordinates for d4qmea4:

Click to download the PDB-style file with coordinates for d4qmea4.
(The format of our PDB-style files is described here.)

Timeline for d4qmea4: