Lineage for d4qmea3 (4qme A:439-539)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2040155Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2040156Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 2040157Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
    PubMed 17876832; N-terminal part of Pfam PF11940
  7. 2040158Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries)
  8. 2040159Domain d4qmea3: 4qme A:439-539 [259984]
    Other proteins in same PDB: d4qmea1, d4qmea2, d4qmea4
    automated match to d2gtqa3
    complexed with 37b, gol, imd, so4, zn

Details for d4qmea3

PDB Entry: 4qme (more details), 1.6 Å

PDB Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qmea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qmea3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

SCOPe Domain Coordinates for d4qmea3:

Click to download the PDB-style file with coordinates for d4qmea3.
(The format of our PDB-style files is described here.)

Timeline for d4qmea3: