![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins) adopts thermolysin-like fold |
![]() | Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:122586] [254836] (9 PDB entries) |
![]() | Domain d4qmea2: 4qme A:189-438 [259983] Other proteins in same PDB: d4qmea1, d4qmea3, d4qmea4 automated match to d2gtqa2 complexed with 37b, gol, imd, so4, zn |
PDB Entry: 4qme (more details), 1.6 Å
SCOPe Domain Sequences for d4qmea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qmea2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]} dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin ldqfalwysq
Timeline for d4qmea2: