Lineage for d4qmea2 (4qme A:189-438)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918339Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 1918340Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)
  7. 1918341Species Neisseria meningitidis [TaxId:122586] [254836] (8 PDB entries)
  8. 1918342Domain d4qmea2: 4qme A:189-438 [259983]
    Other proteins in same PDB: d4qmea1, d4qmea3, d4qmea4
    automated match to d2gtqa2
    complexed with 37b, gol, imd, so4, zn

Details for d4qmea2

PDB Entry: 4qme (more details), 1.6 Å

PDB Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qmea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qmea2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

SCOPe Domain Coordinates for d4qmea2:

Click to download the PDB-style file with coordinates for d4qmea2.
(The format of our PDB-style files is described here.)

Timeline for d4qmea2: