SCOPe 2.06: Domain d4qmea1: 4qme A:2-188

Lineage for d4qmea1 (4qme A:2-188)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)

6. Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species)

7. Species Neisseria meningitidis [TaxId:122586] [254835] (9 PDB entries)

8. Domain d4qmea1: 4qme A:2-188 [259982]
   Other proteins in same PDB: d4qmea2, d4qmea3, d4qmea4
   automated match to d2gtqa1
   complexed with 37b, gol, imd, so4, zn

Details for d4qmea1

PDB Entry: 4qme, 1.6 Å

PDB Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qmea1:

Sequence; same for both SEQRES and ATOM records:

>d4qmea1 b.98.1.1 (A:2-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]}
sktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvk
ingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegf
rkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsy
lfalvag

Timeline for d4qmea1:

• d4qmea1 first appeared in SCOPe 2.04
  
• d4qmea1 appears in SCOPe 2.05
  
• d4qmea1 appears in SCOPe 2.07
  
• d4qmea1 appears in the current release, SCOPe 2.08