Lineage for d4qlth_ (4qlt H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936763Domain d4qlth_: 4qlt H: [259980]
    Other proteins in same PDB: d4qlta_, d4qltb_, d4qlte_, d4qltg_, d4qlti_, d4qltj_, d4qltk_, d4qltl_, d4qltn_, d4qlto_, d4qlts_, d4qltu_, d4qltw_, d4qltx_, d4qlty_, d4qltz_
    automated match to d4eu2i_
    complexed with 39v, mes, mg

Details for d4qlth_

PDB Entry: 4qlt (more details), 2.8 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 2 (PR924)
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qlth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlth_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4qlth_:

Click to download the PDB-style file with coordinates for d4qlth_.
(The format of our PDB-style files is described here.)

Timeline for d4qlth_: