SCOP 1.73: Domain d1anba_: 1anb A:

Lineage for d1anba_ (1anb A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (33 PDB entries)

8. Domain d1anba_: 1anb A: [25998]
   complexed with ben, ca; mutant

Details for d1anba_

PDB Entry: 1anb, 2.8 Å

PDB Description: anionic trypsin mutant with ser 214 replaced by glu

PDB Compounds: (A:) anionic trypsin

SCOP Domain Sequences for d1anba_:

Sequence; same for both SEQRES and ATOM records:

>d1anba_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivewgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1anba_:

• d1anba_ first appeared (with stable ids) in SCOP 1.55, called d1anb__
  
• d1anba_ was called d1anb__ in SCOP 1.71
  
• d1anba_ appears in SCOP 1.75
  
• d1anba_ appears in the current release, SCOPe 2.08