SCOP 1.67: Domain d1anb__: 1anb -

Lineage for d1anb__ (1anb -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries)

8. Domain d1anb__: 1anb - [25998]
   complexed with ben, ca; mutant

Details for d1anb__

PDB Entry: 1anb, 2.8 Å

PDB Description: anionic trypsin mutant with ser 214 replaced by glu

SCOP Domain Sequences for d1anb__:

Sequence; same for both SEQRES and ATOM records:

>d1anb__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivewgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1anb__:

• d1anb__ first appeared (with stable ids) in SCOP 1.55
  
• d1anb__ appears in SCOP 1.65
  
• d1anb__ appears in SCOP 1.69
  
• d1anb__ appears in the current release, SCOPe 2.08, called d1anba_