Lineage for d1anb__ (1anb -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (21 PDB entries) 
Domain d1anb__: 1anb - [25998]
Details for d1anb__
PDB Entry: 1anb (more details), 2.8 Å
PDB Description: anionic trypsin mutant with ser 214 replaced by glu
SCOP Domain Sequences for d1anb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1anb__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivewgygcalpdnpgvytkvcnyvdwiqdtiaan
SCOP Domain Coordinates for d1anb__:
Click to download the PDB-style file with coordinates for d1anb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1anb__:
- d1anb__ appears in SCOP 1.57
- d1anb__ appears in the current release, SCOPe 2.08, called d1anba_
View in 3D