SCOPe 2.06: Domain d4qira3: 4qir A:439-539

Lineage for d4qira3 (4qir A:439-539)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)

6. Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
   PubMed 17876832; N-terminal part of Pfam PF11940

7. Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries)

8. Domain d4qira3: 4qir A:439-539 [259974]
   Other proteins in same PDB: d4qira1, d4qira2, d4qira4
   automated match to d2gtqa3
   complexed with 379, gol, imd, so4, zn

Details for d4qira3

PDB Entry: 4qir, 1.7 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-2-(pyridin-3-yl)ethylglyp[ch2]phe

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qira3:

Sequence; same for both SEQRES and ATOM records:

>d4qira3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

Timeline for d4qira3:

• d4qira3 first appeared in SCOPe 2.04
  
• d4qira3 appears in SCOPe 2.05
  
• d4qira3 appears in SCOPe 2.07
  
• d4qira3 appears in the current release, SCOPe 2.08