![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
![]() | Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins) |
![]() | Protein Aminopeptidase N (APN) domain 3 [254401] (1 species) PubMed 17876832; N-terminal part of Pfam PF11940 |
![]() | Species Neisseria meningitidis [TaxId:122586] [254837] (7 PDB entries) |
![]() | Domain d4qira3: 4qir A:439-539 [259974] Other proteins in same PDB: d4qira1, d4qira2, d4qira4 automated match to d2gtqa3 complexed with 379, gol, imd, so4, zn |
PDB Entry: 4qir (more details), 1.7 Å
SCOPe Domain Sequences for d4qira3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qira3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]} agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk rateavlllteaeqtfllegvteavvpsllrgfsapvhlny
Timeline for d4qira3: