Lineage for d4qira3 (4qir A:439-539)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1525171Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 1525172Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 1525173Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
    PubMed 17876832; N-terminal part of Pfam PF11940
  7. 1525174Species Neisseria meningitidis [TaxId:122586] [254837] (7 PDB entries)
  8. 1525177Domain d4qira3: 4qir A:439-539 [259974]
    Other proteins in same PDB: d4qira1, d4qira2, d4qira4
    automated match to d2gtqa3
    complexed with 379, gol, imd, so4, zn

Details for d4qira3

PDB Entry: 4qir (more details), 1.7 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-2-(pyridin-3-yl)ethylglyp[ch2]phe
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qira3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qira3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

SCOPe Domain Coordinates for d4qira3:

Click to download the PDB-style file with coordinates for d4qira3.
(The format of our PDB-style files is described here.)

Timeline for d4qira3: