SCOPe 2.06: Domain d1ezud_: 1ezu D:

Lineage for d1ezud_ (1ezu D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)

8. Domain d1ezud_: 1ezu D: [25997]
   Other proteins in same PDB: d1ezua_, d1ezub_
   complexed with ca

Details for d1ezud_

PDB Entry: 1ezu, 2.4 Å

PDB Description: ecotin y69f, d70p bound to d102n trypsin

PDB Compounds: (D:) trypsin II, anionic

SCOPe Domain Sequences for d1ezud_:

Sequence; same for both SEQRES and ATOM records:

>d1ezud_ b.47.1.2 (D:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1ezud_:

• d1ezud_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezud_ appears in SCOPe 2.05
  
• d1ezud_ appears in SCOPe 2.07
  
• d1ezud_ appears in the current release, SCOPe 2.08