Lineage for d1ezud_ (1ezu D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 112135Protein Trypsin(ogen) [50515] (7 species)
  7. 112331Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)
  8. 112358Domain d1ezud_: 1ezu D: [25997]
    Other proteins in same PDB: d1ezua_, d1ezub_

Details for d1ezud_

PDB Entry: 1ezu (more details), 2.4 Å

PDB Description: ecotin y69f, d70p bound to d102n trypsin

SCOP Domain Sequences for d1ezud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezud_ b.47.1.2 (D:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1ezud_:

Click to download the PDB-style file with coordinates for d1ezud_.
(The format of our PDB-style files is described here.)

Timeline for d1ezud_: