Lineage for d1ezuc_ (1ezu C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953999Protein Trypsin(ogen) [50515] (9 species)
  7. 954411Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)
  8. 954448Domain d1ezuc_: 1ezu C: [25996]
    Other proteins in same PDB: d1ezua_, d1ezub_
    complexed with ca

Details for d1ezuc_

PDB Entry: 1ezu (more details), 2.4 Å

PDB Description: ecotin y69f, d70p bound to d102n trypsin
PDB Compounds: (C:) trypsin II, anionic

SCOPe Domain Sequences for d1ezuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezuc_ b.47.1.2 (C:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
deqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1ezuc_:

Click to download the PDB-style file with coordinates for d1ezuc_.
(The format of our PDB-style files is described here.)

Timeline for d1ezuc_: