Lineage for d4pjef1 (4pje F:3-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754886Domain d4pjef1: 4pje F:3-115 [259958]
    Other proteins in same PDB: d4pjea1, d4pjeb1, d4pjeb2, d4pjec1, d4pjed1, d4pjed2, d4pjee2, d4pjef2, d4pjeg2, d4pjeh2
    automated match to d3of6c1
    complexed with 30w, act, cl, gol, na

Details for d4pjef1

PDB Entry: 4pje (more details), 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjef1 b.1.1.0 (F:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcastlgqegqpqhfgegsrltvled

SCOPe Domain Coordinates for d4pjef1:

Click to download the PDB-style file with coordinates for d4pjef1.
(The format of our PDB-style files is described here.)

Timeline for d4pjef1: