SCOPe 2.05: Domain d4pjeg2: 4pje G:111-198

Lineage for d4pjeg2 (4pje G:111-198)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4pjeg2: 4pje G:111-198 [259956]
   Other proteins in same PDB: d4pjea1, d4pjea2, d4pjeb_, d4pjec1, d4pjec2, d4pjed_, d4pjee1, d4pjef1, d4pjeg1, d4pjeh1
   automated match to d2f54d2
   complexed with 30w, act, cl, gol, na

Details for d4pjeg2

PDB Entry: 4pje, 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr

PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjeg2:

Sequence; same for both SEQRES and ATOM records:

>d4pjeg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Timeline for d4pjeg2:

• d4pjeg2 first appeared in SCOPe 2.04
  
• d4pjeg2 appears in SCOPe 2.06
  
• d4pjeg2 appears in the current release, SCOPe 2.08