Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d4pjeg1: 4pje G:2-110 [259955] Other proteins in same PDB: d4pjea1, d4pjeb_, d4pjec1, d4pjed_, d4pjee2, d4pjef2, d4pjeg2, d4pjeh2 automated match to d2f54d1 complexed with 30w, act, cl, gol, na |
PDB Entry: 4pje (more details), 1.95 Å
SCOPe Domain Sequences for d4pjeg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjeg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs sflsrskgysylllkelqmkdsasylcagmdsnyqliwgagtkliikpd
Timeline for d4pjeg1: