SCOPe 2.08: Domain d4pjeg1: 4pje G:2-110

Lineage for d4pjeg1 (4pje G:2-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4pjeg1: 4pje G:2-110 [259955]
   Other proteins in same PDB: d4pjea1, d4pjeb1, d4pjeb2, d4pjec1, d4pjed1, d4pjed2, d4pjee2, d4pjef2, d4pjeg2, d4pjeh2
   automated match to d2f54d1
   complexed with 30w, act, cl, gol, na

Details for d4pjeg1

PDB Entry: 4pje, 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr

PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjeg1:

Sequence; same for both SEQRES and ATOM records:

>d4pjeg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcagmdsnyqliwgagtkliikpd

Timeline for d4pjeg1:

• d4pjeg1 first appeared in SCOPe 2.04
  
• d4pjeg1 appears in SCOPe 2.07