SCOPe 2.08: Domain d4pjdf2: 4pjd F:116-237

Lineage for d4pjdf2 (4pjd F:116-237)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4pjdf2: 4pjd F:116-237 [259953]
   Other proteins in same PDB: d4pjda1, d4pjda2, d4pjda3, d4pjdb_, d4pjdc1, d4pjdc2, d4pjdc3, d4pjdd_, d4pjde1, d4pjdf1, d4pjdg1, d4pjdh1
   automated match to d3of6b2
   complexed with 2lj, gol

Details for d4pjdf2

PDB Entry: 4pjd, 2.78 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-c10 tcr

PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjdf2:

Sequence, based on SEQRES records:

>d4pjdf2 b.1.1.2 (F:116-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
ae

Sequence, based on observed residues (ATOM records):

>d4pjdf2 b.1.1.2 (F:116-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnphfrcqvqfyglsendewtqdrakpvtqivsae

Timeline for d4pjdf2:

• d4pjdf2 first appeared in SCOPe 2.04
  
• d4pjdf2 appears in SCOPe 2.07