![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4pjdg2: 4pjd G:111-198 [259949] Other proteins in same PDB: d4pjda1, d4pjda2, d4pjda3, d4pjdb_, d4pjdc1, d4pjdc2, d4pjdc3, d4pjdd_, d4pjde1, d4pjdf1, d4pjdg1, d4pjdh1 automated match to d2f54d2 complexed with 2lj, gol |
PDB Entry: 4pjd (more details), 2.78 Å
SCOPe Domain Sequences for d4pjdg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjdg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
Timeline for d4pjdg2: