Lineage for d4pjdg2 (4pjd G:111-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751301Domain d4pjdg2: 4pjd G:111-198 [259949]
    Other proteins in same PDB: d4pjda1, d4pjda2, d4pjda3, d4pjdb_, d4pjdc1, d4pjdc2, d4pjdc3, d4pjdd_, d4pjde1, d4pjdf1, d4pjdg1, d4pjdh1
    automated match to d2f54d2
    complexed with 2lj, gol

Details for d4pjdg2

PDB Entry: 4pjd (more details), 2.78 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-c10 tcr
PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjdg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjdg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d4pjdg2:

Click to download the PDB-style file with coordinates for d4pjdg2.
(The format of our PDB-style files is described here.)

Timeline for d4pjdg2: