SCOPe 2.08: Domain d4pjxh2: 4pjx H:117-243

Lineage for d4pjxh2 (4pjx H:117-243)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4pjxh2: 4pjx H:117-243 [259947]
   Other proteins in same PDB: d4pjxa1, d4pjxa2, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc1, d4pjxc2, d4pjxd_, d4pjxe1, d4pjxf1, d4pjxg1, d4pjxh1
   automated match to d3of6b2
   complexed with 30w, b3p, cl, gol

Details for d4pjxh2

PDB Entry: 4pjx, 2.25 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-a11 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjxh2:

Sequence; same for both SEQRES and ATOM records:

>d4pjxh2 b.1.1.2 (H:117-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Timeline for d4pjxh2:

• d4pjxh2 first appeared in SCOPe 2.04
  
• d4pjxh2 appears in SCOPe 2.07