| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4pjxg1: 4pjx G:2-110 [259944] Other proteins in same PDB: d4pjxa1, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc1, d4pjxc2, d4pjxd_, d4pjxe2, d4pjxf2, d4pjxg2, d4pjxh2 automated match to d2f54d1 complexed with 30w, b3p, cl, gol |
PDB Entry: 4pjx (more details), 2.25 Å
SCOPe Domain Sequences for d4pjxg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjxg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavrdsnyqliwgagtkliikpd
Timeline for d4pjxg1: