Lineage for d4pjxg1 (4pjx G:2-110)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355951Domain d4pjxg1: 4pjx G:2-110 [259944]
    Other proteins in same PDB: d4pjxa1, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc1, d4pjxc2, d4pjxd_, d4pjxe2, d4pjxf2, d4pjxg2, d4pjxh2
    automated match to d2f54d1
    complexed with 30w, b3p, cl, gol

Details for d4pjxg1

PDB Entry: 4pjx (more details), 2.25 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-a11 tcr
PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjxg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjxg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavrdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d4pjxg1:

Click to download the PDB-style file with coordinates for d4pjxg1.
(The format of our PDB-style files is described here.)

Timeline for d4pjxg1: