Lineage for d4pjxe2 (4pjx E:111-198)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029556Domain d4pjxe2: 4pjx E:111-198 [259943]
    Other proteins in same PDB: d4pjxa1, d4pjxa2, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc1, d4pjxc2, d4pjxd_, d4pjxe1, d4pjxf1, d4pjxg1, d4pjxh1
    automated match to d2f54d2
    complexed with 30w, b3p, cl, gol

Details for d4pjxe2

PDB Entry: 4pjx (more details), 2.25 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-a11 tcr
PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjxe2:

Sequence, based on SEQRES records: (download)

>d4pjxe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4pjxe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmfksnsavawsnksdf
acanafnnsiipedtffp

SCOPe Domain Coordinates for d4pjxe2:

Click to download the PDB-style file with coordinates for d4pjxe2.
(The format of our PDB-style files is described here.)

Timeline for d4pjxe2: