| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4pjxe2: 4pjx E:111-198 [259943] Other proteins in same PDB: d4pjxa1, d4pjxa2, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc1, d4pjxc2, d4pjxd_, d4pjxe1, d4pjxf1, d4pjxg1, d4pjxh1 automated match to d2f54d2 complexed with 30w, b3p, cl, gol |
PDB Entry: 4pjx (more details), 2.25 Å
SCOPe Domain Sequences for d4pjxe2:
Sequence, based on SEQRES records: (download)
>d4pjxe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp
>d4pjxe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmfksnsavawsnksdf
acanafnnsiipedtffp
Timeline for d4pjxe2: