SCOP 1.71: Domain d1amha_: 1amh A:

Lineage for d1amha_ (1amh A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries)

8. Domain d1amha_: 1amh A: [25994]

Details for d1amha_

PDB Entry: 1amh, 2.5 Å

PDB Description: uncomplexed rat trypsin mutant with asp 189 replaced with ser (d189s)

SCOP Domain Sequences for d1amha_:

Sequence; same for both SEQRES and ATOM records:

>d1amha_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggksscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1amha_:

• d1amha_ first appeared (with stable ids) in SCOP 1.55
  
• d1amha_ appears in SCOP 1.69
  
• d1amha_ appears in SCOP 1.73
  
• d1amha_ appears in the current release, SCOPe 2.08