Lineage for d4pjva2 (4pjv A:365-579)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234080Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2234104Protein automated matches [227023] (1 species)
    not a true protein
  7. 2234105Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries)
  8. 2234115Domain d4pjva2: 4pjv A:365-579 [259931]
    Other proteins in same PDB: d4pjva1, d4pjva3, d4pjvb1, d4pjvb3
    automated match to d3kjda2
    complexed with 2yq, gol

Details for d4pjva2

PDB Entry: 4pjv (more details), 2.5 Å

PDB Description: Structure of PARP2 catalytic domain bound to inhibitor BMN 673
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4pjva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjva2 d.166.1.2 (A:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnf

SCOPe Domain Coordinates for d4pjva2:

Click to download the PDB-style file with coordinates for d4pjva2.
(The format of our PDB-style files is described here.)

Timeline for d4pjva2: