Lineage for d1brce_ (1brc E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796618Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2796658Domain d1brce_: 1brc E: [25993]
    Other proteins in same PDB: d1brci_

Details for d1brce_

PDB Entry: 1brc (more details), 2.5 Å

PDB Description: relocating a negative charge in the binding pocket of trypsin
PDB Compounds: (E:) Trypsin

SCOPe Domain Sequences for d1brce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brce_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1brce_:

Click to download the PDB-style file with coordinates for d1brce_.
(The format of our PDB-style files is described here.)

Timeline for d1brce_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1brci_